HA1(H5N2)(A/northern pintail/Washington /40964/2014)-H5-Cambridge Bio

Services

Home page > Products > Microbiology > Influenza virus > HA > H5

HA1(H5N2)(A/northern pintail/Washington /40964/2014)

Cat No.:    01-02-0564
Product Name:    HA1(H5N2)(A/northern pintail/Washington /40964/2014)
Size:    100 μg
Price:    ￥4500

Consultation:

Overview

Download

Cat No.: 01-02-0564
Product Name: HA1(H5N2)(A/northern pintail/Washington /40964/2014)
Description: HA1(H5N2)(A/northern pintail/Washington/40964/2014)
Type: Recombinant Protein
Property: C-terminal 6xHis tagged HA1(H5N2)(A/northern pintail/Washington/40964/2014)
Source: Recombinant protein purified from HEK293 cell culture
Applications: WB standard, antibody ELISA, immunogen, etc
Formulation: Each vial contains 100 µg of purified protein (1 mg/ml) in PBS (pH7.4)
Purity: >95%
Protein: Recombinant human influenza H5N2 virus HA1(H5N2)(A/northern pintail/Washington /40964/2014) (a.a.17-342) protein.
Storage: For short term, store at 4oC, stable for 1 month. For long term storage, aliquot and freeze at -80 °C. Non-hazardous. No MSDS required.
Limitation: For research use only, not for use in diagnostic procedures.
Note: Amino acid sequence: dqicvgyhannstervdtimeknvtvthaqdilekthngklcnlngvkpliled csvagwllgnpmcdkflnvsewsyive kagpanglcypgdfndyeelkhllsrinhfekieiipknhwsnhntsgvssacs ylenpsffrnvvwltkknntyptikvny tnanqkdllvlwgihhpnneaeqkmiyqnsntyvsvgtstlnqrlvpkiatrs kvngqsgr