Services
HA1(A/Guizhou/1/2013)(H5N1)
- Cat No.: 01-02-0570
- Product Name: HA1(A/Guizhou/1/2013)(H5N1)
- Description: HA1(A/Guizhou/1/2013)(H5N1)
- Source: Recombinant protein purified from HEK293 cell culture
- Applications: WB standard, antibody ELISA, immunogen, etc
- Formulation: Each vial contains 100 µg of purified protein (1 mg/ml) in PBS (pH7.4)
- Protein: Recombinant human influenza H5N1 virus HA1(A/Guizhou/1/2013)(H5N1)(aa.17-340) protein.
- Storage: For short term, store at 4oC, stable for 1 month. For long term storage, aliquot and freeze at -80 °C. Non-hazardous. No MSDS required.
- Limitation: For research use only, not for use in diagnostic procedures.
- Note: Amino acid sequence: dqlcigyhannsteqvdtimeknvtvthaqdilerthngklcdldgvkplilrdcsva gwllgnpmcdefinvpewsyivekanpandlcypgnlndyeelkhllsrinhfeki qiipksswtdheaslgvsaacpylgtpsffrnvvwlikknntyptikisynntnqedl lilwgihhsndeteqiklyqnpityvsvgtstlnqrlvpkianrskvngqsgrm
- NP(H1N1)(A/Puerto Rico/8/1934)
- NP(H1N1)(A/Brisbane/59/2007)
- NP(H1N1)(A/06/California/2009)
- NP(H3N2)(A/Brisbane/10/2007)
- NP(H5N1)(A/Thailand/1(KAN-1)/2004)
- NP(H5N1)(A/Indonesia/5/2005)
- NP(H7N7)(A/Netherlands/219/2003)
- NP(H9N2)(A/HK/2108/2003)
- NP(H17N10)(A/little yellow-shoulderedbat/Guatemala/153/2009)
- NP (B/Brisbane/60/2008)
- M1(H1N1)(A/Puerto Rico/8/1934)
- M1(H1N1)(A/New Caledonia/20/1999)
- M1(H1N1)(A/California/04/2009)
- M1(H1N1)(A/California/07/2009)
- M1(H3N2)(A/Wyoming/3/03)
- M1(H3N2)(A/Brisbane/10/2007)
- M1(H3N2)(A/Perth/16/2009)
- M1(H3N2)(A/Victoria/361/2011)
- M1(H5N1)(A/Thailand/1(KAN-1)/2004)
- M1(H7N9)(A/Shanghai/2/2013)
- M1 (B/Yamagata/16/88)
- M1 (B/Malaysia/2506/2004)
- M1 (B/Florida/4/2006)
- M1 (B/Brisbane/60/2008)
- M1(B/Hubei Wujigang/158/2009)
- NS1(H1N1)(A/California/06/2009)
- NS1(H1N1)(A/California/06/2009)
- NS1(H3N2)(A/Brisbane/10/2007)
- HA1(H5N2)(A/chicken/Iowa/04-20/2015)
- HA1(H5N8) (A/tufted duck/Germany-SH/ R8444/2016)
- HA1(A/chicken/Ghana/20/2015)(H5N1)
- HA1(A/duck/Hyogo/1/2016)(H5N6)
- HA1(A/Hubei/29578/2016)(H5N6)
- HA1(A/tufted duck/Germany-SH/R8444/2016)
- HA1(A/chicken/Iowa/04-20/2015) (H5N2)
- HA1(A/Guizhou/1/2013)(H5N1)
- HA1(A/northern pintail/Washington/40964/2014) (H5N2)
- Anti-G (RSV) (3G12)
- Anti-F (RSV) (MEDI8897)
- Anti-G (RSV) (CB017.5)
- Anti-G (RSV) (CB002.5)
Overview
Related products
Download
